(data stored in ACNUC1104 zone)

EMBL: CP001966.PE181

CP001966.PE181       Location/Qualifiers
FT   CDS             194055..194900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0181"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: mgi:Mflv_4009
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76835"
FT                   /db_xref="GOA:D5UQK2"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK2"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ADG76835.1"
FT                   /translation="MNAAQPERFDAAARSRTDIVVLDIEDAVAPKDKVAARTNVVDWLN
FT                   SENDGVPNSGWVRVNGFGTQWWADDLEALRGAQHLGGIMLAMVESMDHVTETAKRLPDT
FT                   LIVALVETARGLERISEIASAKGTFRLAFGIGDFRRDTGFGGDPTTLAYARSRFTIAAK
FT                   AAHLPGAIDGPTVGSKGLLLSEATAVSAEFGMTGKICLTPDQCHPVNEGLSPSPEDIRW
FT                   SREFFAEFDRDGGEIRNGSDLPRIARATKILDLARAYGIEVSDGLEGEHAPAPSDTFHY
FT                   "
     MNAAQPERFD AAARSRTDIV VLDIEDAVAP KDKVAARTNV VDWLNSENDG VPNSGWVRVN        60
     GFGTQWWADD LEALRGAQHL GGIMLAMVES MDHVTETAKR LPDTLIVALV ETARGLERIS       120
     EIASAKGTFR LAFGIGDFRR DTGFGGDPTT LAYARSRFTI AAKAAHLPGA IDGPTVGSKG       180
     LLLSEATAVS AEFGMTGKIC LTPDQCHPVN EGLSPSPEDI RWSREFFAEF DRDGGEIRNG       240
     SDLPRIARAT KILDLARAYG IEVSDGLEGE HAPAPSDTFH Y                           281
//

If you have problems or comments...

PBIL Back to PBIL home page