(data stored in ACNUC1104 zone)

EMBL: CP001966.PE183

CP001966.PE183       Location/Qualifiers
FT   CDS             complement(195428..197104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0183"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="KEGG: mgi:Mflv_0749 phosphoenolpyruvate-protein
FT                   phosphotransferase; TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76837"
FT                   /db_xref="GOA:D5UQK4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK4"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADG76837.1"
FT                   /translation="MSSQQSTVTVLAGTAVVPGVAYAPVMWPGERPELPAVGGELPETE
FT                   RDAEAVRLSSAARTVAGRLRERASQATGAASEVLAATAGLASDKAWLSAAEKLIRSGSP
FT                   AEGAVAAATEQFADMFTTIGGLMAERVTDLRDVRDRVLAELLGRPEPGVPTPTAPSVLL
FT                   ADDLAPADTAGLDPALVVGIGTRLGGPTSHTAIIARQLGIPCIVGLAEAGTVEAGTLVL
FT                   LDGAEGTVTVAPPADGARARVAEAMRMAEDVARWRGPGRTSDGTAVAILANVQDGPSAR
FT                   TAAERQVEGVGLFRTELAFLNRADEPSVDEQQALYREVIDAFPAGKVVIRTLDAGSDKP
FT                   LKFIDHGHEDNPALGIRGIRIAATDPGLLERQLDAIAAAATGAAEAPWVMAPMIATAAE
FT                   ARSFAAQCRARGLTPGVMIEVPAAALCAEAVLAEVDFVSVGTNDLTQYAMAADRMSSEL
FT                   AALTDPWQPAVLRLIRLTADAGAGAGKPVGVCGEAAADPLLACVLVGLGVTSLSCAAGA
FT                   AAAVGARLGGVTLQQCRWAAEAAVASADPQAARDAARRALS"
     MSSQQSTVTV LAGTAVVPGV AYAPVMWPGE RPELPAVGGE LPETERDAEA VRLSSAARTV        60
     AGRLRERASQ ATGAASEVLA ATAGLASDKA WLSAAEKLIR SGSPAEGAVA AATEQFADMF       120
     TTIGGLMAER VTDLRDVRDR VLAELLGRPE PGVPTPTAPS VLLADDLAPA DTAGLDPALV       180
     VGIGTRLGGP TSHTAIIARQ LGIPCIVGLA EAGTVEAGTL VLLDGAEGTV TVAPPADGAR       240
     ARVAEAMRMA EDVARWRGPG RTSDGTAVAI LANVQDGPSA RTAAERQVEG VGLFRTELAF       300
     LNRADEPSVD EQQALYREVI DAFPAGKVVI RTLDAGSDKP LKFIDHGHED NPALGIRGIR       360
     IAATDPGLLE RQLDAIAAAA TGAAEAPWVM APMIATAAEA RSFAAQCRAR GLTPGVMIEV       420
     PAAALCAEAV LAEVDFVSVG TNDLTQYAMA ADRMSSELAA LTDPWQPAVL RLIRLTADAG       480
     AGAGKPVGVC GEAAADPLLA CVLVGLGVTS LSCAAGAAAA VGARLGGVTL QQCRWAAEAA       540
     VASADPQAAR DAARRALS                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page