(data stored in ACNUC1104 zone)

EMBL: CP001966.PE189

CP001966.PE189       Location/Qualifiers
FT   CDS             202037..202954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0189"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: rer:RER_37880 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76843"
FT                   /db_xref="GOA:D5UQL0"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL0"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADG76843.1"
FT                   /translation="MPQDGPVIAVGPTPDPEFDAAITRGGGVPGPLAGAEGLVWIDSTT
FT                   VPTDIPDSVRWVQLPFAGIENFVGSGLLEHYPGITFSSAAGAYSTTVAEHALSLLLAGV
FT                   RGLWHRESEWDAKGAAPRVGLLGGSTVAIVGAGGIGRDLAPQLRALGVSVIAVNRSGSD
FT                   VTGAVVVTADKLDEVWSQVDHVVLAAPATAETRSLVDASVLAQLKPHSWVINVARGALI
FT                   DTDALVDALRRGAIGGVGLDVTDPEPLPGDHPLWSIPNAIITPHVANPPQHLRPALLDR
FT                   VEINVRRVANGLQPLAVVDRAKGY"
     MPQDGPVIAV GPTPDPEFDA AITRGGGVPG PLAGAEGLVW IDSTTVPTDI PDSVRWVQLP        60
     FAGIENFVGS GLLEHYPGIT FSSAAGAYST TVAEHALSLL LAGVRGLWHR ESEWDAKGAA       120
     PRVGLLGGST VAIVGAGGIG RDLAPQLRAL GVSVIAVNRS GSDVTGAVVV TADKLDEVWS       180
     QVDHVVLAAP ATAETRSLVD ASVLAQLKPH SWVINVARGA LIDTDALVDA LRRGAIGGVG       240
     LDVTDPEPLP GDHPLWSIPN AIITPHVANP PQHLRPALLD RVEINVRRVA NGLQPLAVVD       300
     RAKGY                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page