(data stored in ACNUC1104 zone)

EMBL: CP001966.PE193

CP001966.PE193       Location/Qualifiers
FT   CDS             complement(206711..207361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0193"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ach:Achl_2748 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76847"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG76847.1"
FT                   /translation="MARIAIIGGHGKVALLLAQVLSARGDQVTSWIRNPEHAPDVTATG
FT                   ATPLVLDVENASRDEIANALAGNDAVVFSAGAGGGNPDRTYAVDRDAAIRSVQAAEQAG
FT                   VRRYLMVSYLGAAPDHGVPESDPFFHYAEAKAAADVAVRASDLDWTVLMPGRLTLDEPS
FT                   GRVDPAAERAADNPGTSRANVALVAASALDRPDTIGKDLPFTDGDVTIEQAWA"
     MARIAIIGGH GKVALLLAQV LSARGDQVTS WIRNPEHAPD VTATGATPLV LDVENASRDE        60
     IANALAGNDA VVFSAGAGGG NPDRTYAVDR DAAIRSVQAA EQAGVRRYLM VSYLGAAPDH       120
     GVPESDPFFH YAEAKAAADV AVRASDLDWT VLMPGRLTLD EPSGRVDPAA ERAADNPGTS       180
     RANVALVAAS ALDRPDTIGK DLPFTDGDVT IEQAWA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page