(data stored in ACNUC1104 zone)

EMBL: CP001966.PE196

CP001966.PE196       Location/Qualifiers
FT   CDS             209019..210491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0196"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="KEGG: mgi:Mflv_0311 phosphoesterase, PA-phosphatase
FT                   related; PFAM: phosphoesterase PA-phosphatase related;
FT                   diacylglycerol kinase catalytic region; SMART:
FT                   phosphoesterase PA-phosphatase related; diacylglycerol
FT                   kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76850"
FT                   /db_xref="GOA:D5UQL7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL7"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADG76850.1"
FT                   /translation="MAESAIRSLRRGFSELDGKLFDAVADSSSPLLDHTMRPLSAAADH
FT                   SVLWMAIAAGMSTGGLSLRRGAVRGLASLAVTSLVVNQGLKRIYPRARPAFAGVPVKRA
FT                   RRQPTSNSFPSGHAASAAAFAVGVGLENHSAGYLLGALAAAVGLSRVATGAHYPADVLA
FT                   GFAVGAGIAAAGARLVPPVDEGCSTTPAPTVEQVRPAPDGAGLVVILNPSSGDGTGRRV
FT                   ANELRAALPGAEIVELEPGADVAAIAAEAASRAEFLGVAGGDGTVATVAAQAVAADTPL
FT                   AVFPAGTFNHFAKDIGSDTVSAAVDFLRRGMVTRVDVVWLNEEKMLLNTASIGAYPEFV
FT                   RTRSRLQRRRIGRPSATVRAILKVLRNSAPVRVRIGGRPVTVSFFFLGNSQYGAAGFVP
FT                   GRRSRLDDGMLDVRYLEDGHRNAAARLLLSWLSGRITTSKIYREVQAPEVTIEADRPFR
FT                   VAHDGEAGDLHTRAHFRVGHRALRVFGRSEVG"
     MAESAIRSLR RGFSELDGKL FDAVADSSSP LLDHTMRPLS AAADHSVLWM AIAAGMSTGG        60
     LSLRRGAVRG LASLAVTSLV VNQGLKRIYP RARPAFAGVP VKRARRQPTS NSFPSGHAAS       120
     AAAFAVGVGL ENHSAGYLLG ALAAAVGLSR VATGAHYPAD VLAGFAVGAG IAAAGARLVP       180
     PVDEGCSTTP APTVEQVRPA PDGAGLVVIL NPSSGDGTGR RVANELRAAL PGAEIVELEP       240
     GADVAAIAAE AASRAEFLGV AGGDGTVATV AAQAVAADTP LAVFPAGTFN HFAKDIGSDT       300
     VSAAVDFLRR GMVTRVDVVW LNEEKMLLNT ASIGAYPEFV RTRSRLQRRR IGRPSATVRA       360
     ILKVLRNSAP VRVRIGGRPV TVSFFFLGNS QYGAAGFVPG RRSRLDDGML DVRYLEDGHR       420
     NAAARLLLSW LSGRITTSKI YREVQAPEVT IEADRPFRVA HDGEAGDLHT RAHFRVGHRA       480
     LRVFGRSEVG                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page