(data stored in ACNUC1104 zone)

EMBL: CP001966.PE197

CP001966.PE197       Location/Qualifiers
FT   CDS             complement(210488..211297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_0488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76851"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76851.1"
FT                   /translation="MALAFALVGVVSAAGCGLTPSSRPSSPEPSRFTRTEAAATTPSVA
FT                   PYAVDAPGRTVAVAPRPTTGAGITTFADSFGFYASVCTLGFFARYPNGQVVAFTAGHCA
FT                   DLARQARPDDAPVARYLTSASRSTAFGEYIKATRTRRGQDIAIIQVLGADVRAVADAIG
FT                   PVTGYSTAAELRDGRPEICIVGARTGRSCGVFDTIDGRRVTWAGTPAVEGDSGGPVYAR
FT                   WPDGTFTAVGVVNSVHTRADGTGTGGGSGTLVADDILANSMTLMGTT"
     MALAFALVGV VSAAGCGLTP SSRPSSPEPS RFTRTEAAAT TPSVAPYAVD APGRTVAVAP        60
     RPTTGAGITT FADSFGFYAS VCTLGFFARY PNGQVVAFTA GHCADLARQA RPDDAPVARY       120
     LTSASRSTAF GEYIKATRTR RGQDIAIIQV LGADVRAVAD AIGPVTGYST AAELRDGRPE       180
     ICIVGARTGR SCGVFDTIDG RRVTWAGTPA VEGDSGGPVY ARWPDGTFTA VGVVNSVHTR       240
     ADGTGTGGGS GTLVADDILA NSMTLMGTT                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page