(data stored in ACNUC1104 zone)

EMBL: CP001966.PE199

CP001966.PE199       Location/Qualifiers
FT   CDS             complement(212210..212596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro00326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76853"
FT                   /db_xref="GOA:D5UQM0"
FT                   /db_xref="InterPro:IPR035197"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM0"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro00326"
FT                   /protein_id="ADG76853.1"
FT                   /translation="MTDLHRPDPLHYLAWVYTGKLPAKNRSWVRHTLTCRTWVARHLAR
FT                   GQLAMVPVYGLLLLLPGPVGLRAATVLLGVLLNAFYNAAYIRPNRARRLEKNGLDPALE
FT                   NPHAVERRAATRLAYESAHAAERA"
     MTDLHRPDPL HYLAWVYTGK LPAKNRSWVR HTLTCRTWVA RHLARGQLAM VPVYGLLLLL        60
     PGPVGLRAAT VLLGVLLNAF YNAAYIRPNR ARRLEKNGLD PALENPHAVE RRAATRLAYE       120
     SAHAAERA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page