(data stored in ACNUC1104 zone)

EMBL: CP001966.PE200

CP001966.PE200       Location/Qualifiers
FT   CDS             complement(212597..213076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0200"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: rer:RER_45540 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76854"
FT                   /db_xref="GOA:D5UQM1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG76854.1"
FT                   /translation="MTDSDAPTVDGDPLALERQVCFALAVANRAVLSVYRPILAPMGLT
FT                   HPQYLVMLALWGAAPMSVKEIGEALQLDSPTLSPLLKRLEAQGLITRSRAAHDERQIDV
FT                   DLTDAGRALREQALNVPPAVIERLGASLSELEDLHRVLTTINARALAAGALERET"
     MTDSDAPTVD GDPLALERQV CFALAVANRA VLSVYRPILA PMGLTHPQYL VMLALWGAAP        60
     MSVKEIGEAL QLDSPTLSPL LKRLEAQGLI TRSRAAHDER QIDVDLTDAG RALREQALNV       120
     PPAVIERLGA SLSELEDLHR VLTTINARAL AAGALERET                              159
//

If you have problems or comments...

PBIL Back to PBIL home page