(data stored in ACNUC1104 zone)

EMBL: CP001966.PE204

CP001966.PE204       Location/Qualifiers
FT   CDS             complement(217064..217945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0204"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; dTDP-4-
FT                   dehydrorhamnose reductase; Male sterility domain; KEGG:
FT                   acp:A2cp1_1649 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76858"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM5"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG76858.1"
FT                   /translation="MRYLVTGASGFVGTAVTAELIAAGHEVRGLVRSDRAAEAIRSLGA
FT                   EPVLGTIEDTDLLRAAAAASDGVVHLAFNHDFSRFEESARVERGAIEAFGTALEGSDRP
FT                   LAIASGVAGLTSGRTAVESDRPAPGSPRSGNADAALALADRGVRATVVRLAPSVHDASP
FT                   AGFVAHLVETARATGSSGYVGDGEQRWAAVHRADAARLFRLAVERGRAGEVYHAVGEEG
FT                   VPTRAIAEAVAALTGVDVAPVPDAEAAHRFGFLAGILALDSPASNAWTRERFGWNPTGP
FT                   GLLADIAAWPGA"
     MRYLVTGASG FVGTAVTAEL IAAGHEVRGL VRSDRAAEAI RSLGAEPVLG TIEDTDLLRA        60
     AAAASDGVVH LAFNHDFSRF EESARVERGA IEAFGTALEG SDRPLAIASG VAGLTSGRTA       120
     VESDRPAPGS PRSGNADAAL ALADRGVRAT VVRLAPSVHD ASPAGFVAHL VETARATGSS       180
     GYVGDGEQRW AAVHRADAAR LFRLAVERGR AGEVYHAVGE EGVPTRAIAE AVAALTGVDV       240
     APVPDAEAAH RFGFLAGILA LDSPASNAWT RERFGWNPTG PGLLADIAAW PGA              293
//

If you have problems or comments...

PBIL Back to PBIL home page