(data stored in ACNUC1104 zone)

EMBL: CP001966.PE210

CP001966.PE210       Location/Qualifiers
FT   CDS             223887..225317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0210"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mva:Mvan_4580 H+ antiporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76864"
FT                   /db_xref="GOA:D5UQN1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76864.1"
FT                   /translation="MVEVNREKPVEYAVVRRHRRKVHTDLGSRQHVPRMLRPLLRRDYR
FT                   LLFVTLLCALTTDGMWLVSVVWQVIDMGGSATSVSLVSGAASVGLLVSTLAGGVLADRV
FT                   SQQRILFVLELLKVVVIGGVGVLALTGAITIPLLMAGSLALGLVSGFYFPAYSALVPRL
FT                   VPPDELLAVNGYESAVRPAAAMAVGPAVAAWIIAVASPGAALLVGGAICLFAALWVVRI
FT                   RVPRTEAADEAEPGSPLRELWEGIKYVRQTPWLLATLLFASLMVLVTVGPIDVLLPFAI
FT                   KDQAHGAASEHSMILAAYGFGGVAGALFMAARRMPRRYLTVMMGVWGIASLPMLVFGIA
FT                   ESVWPMVIAGFVLGVLFEAPVVIWGTLLQRRVPRRLLGRVSSLDFFVSLVFMPVSFALA
FT                   GPVSQAIGLTATFVLAALVPVPLAVIAILAARMPQDELAHPLVDEDDEDDGTGAAGDAA
FT                   DAPVTPTVNAPAPEGTVG"
     MVEVNREKPV EYAVVRRHRR KVHTDLGSRQ HVPRMLRPLL RRDYRLLFVT LLCALTTDGM        60
     WLVSVVWQVI DMGGSATSVS LVSGAASVGL LVSTLAGGVL ADRVSQQRIL FVLELLKVVV       120
     IGGVGVLALT GAITIPLLMA GSLALGLVSG FYFPAYSALV PRLVPPDELL AVNGYESAVR       180
     PAAAMAVGPA VAAWIIAVAS PGAALLVGGA ICLFAALWVV RIRVPRTEAA DEAEPGSPLR       240
     ELWEGIKYVR QTPWLLATLL FASLMVLVTV GPIDVLLPFA IKDQAHGAAS EHSMILAAYG       300
     FGGVAGALFM AARRMPRRYL TVMMGVWGIA SLPMLVFGIA ESVWPMVIAG FVLGVLFEAP       360
     VVIWGTLLQR RVPRRLLGRV SSLDFFVSLV FMPVSFALAG PVSQAIGLTA TFVLAALVPV       420
     PLAVIAILAA RMPQDELAHP LVDEDDEDDG TGAAGDAADA PVTPTVNAPA PEGTVG           476
//

If you have problems or comments...

PBIL Back to PBIL home page