(data stored in ACNUC1104 zone)

EMBL: CP001966.PE211

CP001966.PE211       Location/Qualifiers
FT   CDS             225328..225654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0211"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: rsa:RSal33209_1649 trancriptional regulator,
FT                   PopR-like protein; PFAM: helix-turn-helix domain protein;
FT                   SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76865"
FT                   /db_xref="GOA:D5UQN2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG76865.1"
FT                   /translation="MTSGVASIDTHEPMEAQVPPRPPLLREVYGRVLRQERTRQGRTLA
FT                   EVAREAGVSTQYLSEVERGRKEASSEVLSSVCDALGGSLIEFVGGVHRELVGSRPAPVA
FT                   LAAA"
     MTSGVASIDT HEPMEAQVPP RPPLLREVYG RVLRQERTRQ GRTLAEVARE AGVSTQYLSE        60
     VERGRKEASS EVLSSVCDAL GGSLIEFVGG VHRELVGSRP APVALAAA                    108
//

If you have problems or comments...

PBIL Back to PBIL home page