(data stored in ACNUC1104 zone)

EMBL: CP001966.PE216

CP001966.PE216       Location/Qualifiers
FT   CDS             complement(229685..230569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0216"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: msm:MSMEG_2181 cell filamentation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76870"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN7"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ADG76870.1"
FT                   /translation="MSAARPLRDIAGPLRNLVPERAVSLHGAIANSVLEGWEPRLQDIE
FT                   RLAAMADGAVTLARYVEAAIERALASAAAVGAPDCVDVPVGFPDTVYPETRVLRNRFGI
FT                   RDAQALRQLEFEVGTAQEFGIETGLTELAQTFDGGHLAAIHRTLFGTVYPWAGVFRKYD
FT                   MALGHTTFHAHWISRYLGDAATMLNHRLPHQPIELMGPQRDRQHYARQAAEAYAYLNCA
FT                   HPFREGNGRSSKTLLQVLAAKAGYRFDYSAVSKKQWDTASRRSAPDYGHYRPDAHPLFS
FT                   VFTTITAPLTASA"
     MSAARPLRDI AGPLRNLVPE RAVSLHGAIA NSVLEGWEPR LQDIERLAAM ADGAVTLARY        60
     VEAAIERALA SAAAVGAPDC VDVPVGFPDT VYPETRVLRN RFGIRDAQAL RQLEFEVGTA       120
     QEFGIETGLT ELAQTFDGGH LAAIHRTLFG TVYPWAGVFR KYDMALGHTT FHAHWISRYL       180
     GDAATMLNHR LPHQPIELMG PQRDRQHYAR QAAEAYAYLN CAHPFREGNG RSSKTLLQVL       240
     AAKAGYRFDY SAVSKKQWDT ASRRSAPDYG HYRPDAHPLF SVFTTITAPL TASA             294
//

If you have problems or comments...

PBIL Back to PBIL home page