(data stored in ACNUC1104 zone)

EMBL: CP001966.PE217

CP001966.PE217       Location/Qualifiers
FT   CDS             complement(230579..232114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0217"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sma:SAV_1689 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76871"
FT                   /db_xref="GOA:D5UQN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG76871.1"
FT                   /translation="MATSLAVSALTLHWPDGTVVFDDLSFTVPAGHAALVGANGAGKST
FT                   MLRILAGLITPTSGSVSGTGVVGYVPQHPQARAENTLADALGIGTALAALRRIEGGSAE
FT                   PSDFDAVGDDWDVEERATAALNGLGLRLGALDRTVGTLSGGEATLLAIAGQLLRRPDTL
FT                   LLDEPTNNLDAHARELLTDALDRFTGTAVVVSHDLALLERMATMIELYRGDVRVFGGPY
FT                   SHYREVLDAEQAAAEQAVTTAAGDLKAQKRDLVEAQTKLAKRKRYADKAEAQKRVPPIL
FT                   AGLLKQKAEVSAGKHRVLHEGRVDSAQDALAQAQEAVRDDRSVRIAMPDPGPGVHRVQL
FT                   DDPSLQVIGPERIALVGPNGSGKTTVLRRAIASARAAEPATVIGYVPQNVRFGADEDAT
FT                   LIDAVRTAHPDLDAQQAYAALARMLFRGKQAERIVGTLSGGERLRLALAIALLGNPAPS
FT                   LLVLDEPTNNLDIESVELLVEALLDWRGALAVVSHDRGFLDRLDLTREVEVSR"
     MATSLAVSAL TLHWPDGTVV FDDLSFTVPA GHAALVGANG AGKSTMLRIL AGLITPTSGS        60
     VSGTGVVGYV PQHPQARAEN TLADALGIGT ALAALRRIEG GSAEPSDFDA VGDDWDVEER       120
     ATAALNGLGL RLGALDRTVG TLSGGEATLL AIAGQLLRRP DTLLLDEPTN NLDAHARELL       180
     TDALDRFTGT AVVVSHDLAL LERMATMIEL YRGDVRVFGG PYSHYREVLD AEQAAAEQAV       240
     TTAAGDLKAQ KRDLVEAQTK LAKRKRYADK AEAQKRVPPI LAGLLKQKAE VSAGKHRVLH       300
     EGRVDSAQDA LAQAQEAVRD DRSVRIAMPD PGPGVHRVQL DDPSLQVIGP ERIALVGPNG       360
     SGKTTVLRRA IASARAAEPA TVIGYVPQNV RFGADEDATL IDAVRTAHPD LDAQQAYAAL       420
     ARMLFRGKQA ERIVGTLSGG ERLRLALAIA LLGNPAPSLL VLDEPTNNLD IESVELLVEA       480
     LLDWRGALAV VSHDRGFLDR LDLTREVEVS R                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page