(data stored in ACNUC1104 zone)

EMBL: CP001966.PE22

CP001966.PE22        Location/Qualifiers
FT   CDS             23704..24237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0022"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="KEGG: msm:MSMEG_0024 peptidyl-prolyl cis-trans
FT                   isomerase B; PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76676"
FT                   /db_xref="GOA:D5UPC4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC4"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADG76676.1"
FT                   /translation="MTNSNATAHATLHTSEGDIRIALFGNHAPVTVANFVGLAQGTKEY
FT                   TTTNASGGTSGPFYDGSIFHRVIDGFMIQGGDPTGTGTGGPGYDFVDEFHPELKFDRPY
FT                   LLAMANIGRPATNGSQFFVTVGKTPHLNNRHTIFGEVEDEDSKRVIDAIGQAPTDRADR
FT                   PIKEVTINSITIEP"
     MTNSNATAHA TLHTSEGDIR IALFGNHAPV TVANFVGLAQ GTKEYTTTNA SGGTSGPFYD        60
     GSIFHRVIDG FMIQGGDPTG TGTGGPGYDF VDEFHPELKF DRPYLLAMAN IGRPATNGSQ       120
     FFVTVGKTPH LNNRHTIFGE VEDEDSKRVI DAIGQAPTDR ADRPIKEVTI NSITIEP          177
//

If you have problems or comments...

PBIL Back to PBIL home page