(data stored in ACNUC1104 zone)

EMBL: CP001966.PE225

CP001966.PE225       Location/Qualifiers
FT   CDS             complement(239949..240716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0225"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: bcz:BCZK2732
FT                   CAAX amino protease"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76879"
FT                   /db_xref="GOA:D5UQP6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP6"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADG76879.1"
FT                   /translation="MNADLLVRARAFFANQPADASCLLVLIRVIWVSASIVALMAPEEL
FT                   YEQDLSRGVVLAAVAATVGIVVVVGGHWLTQSSLLPSSRWLGFALPRRWWLWLPVGAAA
FT                   GFGLSRGLTALHLPQLWPALTDSTAQQLANNEQREAEAFTWTDWTHAAGEEVIFRMPVV
FT                   AAACFALGFTGARMPDASRARLSILAGVVIATALLFGLIHLDYGWYNVVTTWVLGAGCA
FT                   AIAIASRSVWPAATLHAAYNTANHFPDIVWSLW"
     MNADLLVRAR AFFANQPADA SCLLVLIRVI WVSASIVALM APEELYEQDL SRGVVLAAVA        60
     ATVGIVVVVG GHWLTQSSLL PSSRWLGFAL PRRWWLWLPV GAAAGFGLSR GLTALHLPQL       120
     WPALTDSTAQ QLANNEQREA EAFTWTDWTH AAGEEVIFRM PVVAAACFAL GFTGARMPDA       180
     SRARLSILAG VVIATALLFG LIHLDYGWYN VVTTWVLGAG CAAIAIASRS VWPAATLHAA       240
     YNTANHFPDI VWSLW                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page