(data stored in ACNUC1104 zone)

EMBL: CP001966.PE226

CP001966.PE226       Location/Qualifiers
FT   CDS             complement(240730..241104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76880"
FT                   /db_xref="GOA:D5UQP7"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76880.1"
FT                   /translation="MNSAATTIMLAAGNPADAPMPFFEMYIRPLILIGVGLFVVTWPLW
FT                   LVLAFVLAKPRGMARSAMLAARTPEQYRIARRRRNWLVFWHTLACVLGLGPFFAVAFGA
FT                   IKGPVIAPQARSYPVHYPYQ"
     MNSAATTIML AAGNPADAPM PFFEMYIRPL ILIGVGLFVV TWPLWLVLAF VLAKPRGMAR        60
     SAMLAARTPE QYRIARRRRN WLVFWHTLAC VLGLGPFFAV AFGAIKGPVI APQARSYPVH       120
     YPYQ                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page