(data stored in ACNUC1104 zone)

EMBL: CP001966.PE23

CP001966.PE23        Location/Qualifiers
FT   CDS             24555..25049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0023"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: rop:ROP_08530 NlpC/P60
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76677"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC5"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADG76677.1"
FT                   /translation="MTSDSTKTTSRTRAAFGASVAVIGLVASPAVALAAPAPQLPAPQA
FT                   PAPQAAAAPDRGAVVQAALTRVGMPYQYGASGPSSFDCSGLVSWAMNQAGLSVPRSSYS
FT                   LMSAGVPVSRGELRPGDVVITNGGGHAALYVGNGQVVEAVTYGTPVRVSDIRGFVTARR
FT                   F"
     MTSDSTKTTS RTRAAFGASV AVIGLVASPA VALAAPAPQL PAPQAPAPQA AAAPDRGAVV        60
     QAALTRVGMP YQYGASGPSS FDCSGLVSWA MNQAGLSVPR SSYSLMSAGV PVSRGELRPG       120
     DVVITNGGGH AALYVGNGQV VEAVTYGTPV RVSDIRGFVT ARRF                        164
//

If you have problems or comments...

PBIL Back to PBIL home page