(data stored in ACNUC1104 zone)

EMBL: CP001966.PE230

CP001966.PE230       Location/Qualifiers
FT   CDS             complement(244748..245608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to aspartic acid-rich protein
FT                   aspolin2-1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76884"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76884.1"
FT                   /translation="MEPCDAEAVGAAESPPDSPASPDFPVEAPDAPPLVERSGFSLGVE
FT                   PDEEPTDEDEPGEAEPEEVPDESDPDEPDSEGADEDASDPEPGDADDRDSDGLDSDDAE
FT                   PDDPDDPDDADSDDVDEVSPSGTAADADGDDGNNAAATNAPPKTTTPTTPRATPTTSGC
FT                   TPRPLPRPPTPSIRARGACPGLAPDAVRRRSREPNTALSRSQTRPTTTQHTTANTTEYT
FT                   AGTVISSYPPSEPPTSEHRQFHSFAQKYRPPLPPRPQQASTTPRRNHHQKRRQRPSCSG
FT                   KSSIL"
     MEPCDAEAVG AAESPPDSPA SPDFPVEAPD APPLVERSGF SLGVEPDEEP TDEDEPGEAE        60
     PEEVPDESDP DEPDSEGADE DASDPEPGDA DDRDSDGLDS DDAEPDDPDD PDDADSDDVD       120
     EVSPSGTAAD ADGDDGNNAA ATNAPPKTTT PTTPRATPTT SGCTPRPLPR PPTPSIRARG       180
     ACPGLAPDAV RRRSREPNTA LSRSQTRPTT TQHTTANTTE YTAGTVISSY PPSEPPTSEH       240
     RQFHSFAQKY RPPLPPRPQQ ASTTPRRNHH QKRRQRPSCS GKSSIL                      286
//

If you have problems or comments...

PBIL Back to PBIL home page