(data stored in ACNUC1104 zone)

EMBL: CP001966.PE231

CP001966.PE231       Location/Qualifiers
FT   CDS             246684..248798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to CG4090-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76885"
FT                   /db_xref="GOA:D5UQQ2"
FT                   /db_xref="InterPro:IPR028949"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76885.1"
FT                   /translation="MPKFDYSVPAPAKGEYAFSLFGLFSINPFSGNTSVLGIKFNLWDT
FT                   VGNIAGGVGKAIDGVGKAIDGIVSPKPKDDGKPAIPGTTPQPFAQVVVGAAAFILLFGA
FT                   IYFATLPPQQRQDLIRRGTEPLNQWWNNARDRIHDLLNPAEPEAKTPTIGGEVKPPAQG
FT                   ATEPPHTTPNPVPSNPVSPVTPDLPAAPFTTPGGNGTGAGTVGTPTRPGTQIPAVPAGN
FT                   PGISTPAPGGGQDDPNNDDDDGPDKNPDKDTDHQSYPAGGIIGAGLGGASIETPGLPTT
FT                   PGTNPPEPNNGTPGTTTPLDPDHHLDPNKPDKATPVEIKPEPTAPKNPILGLAENILGF
FT                   FFPKPKPAIPEPSTPEHPGGTTTGTGTNNNSSKGDGGDSGDGGGDSAANSGNTGATTPS
FT                   TPATSNGEGPGSNGSSSTHEPPASTPTAGYPVDTLAKLATSEVYGPELEAVVAALQKEA
FT                   TGPTVSDVQAAQKRLIEQGNQAPAVDAMVNIVASMLAARDKQELAAAQQHLEDIAAKLG
FT                   VPVANLPKTDDMYLFPMSAAPTNPTHSPYERIRELLTQITWHNSQTVQEAYDQAKNRTY
FT                   SSAEAEQARKDFRDQLRTSGYEALLEMGYRPDAADSLSKSIAEQLMKKLVVTHNPDRIV
FT                   GGRSDKMVTFGDSRTNSSIGNANQRGAAAYLAWLEVQMKKNPDAIVRFDFVEPDDPETP
FT                   STTPPGGTDD"
     MPKFDYSVPA PAKGEYAFSL FGLFSINPFS GNTSVLGIKF NLWDTVGNIA GGVGKAIDGV        60
     GKAIDGIVSP KPKDDGKPAI PGTTPQPFAQ VVVGAAAFIL LFGAIYFATL PPQQRQDLIR       120
     RGTEPLNQWW NNARDRIHDL LNPAEPEAKT PTIGGEVKPP AQGATEPPHT TPNPVPSNPV       180
     SPVTPDLPAA PFTTPGGNGT GAGTVGTPTR PGTQIPAVPA GNPGISTPAP GGGQDDPNND       240
     DDDGPDKNPD KDTDHQSYPA GGIIGAGLGG ASIETPGLPT TPGTNPPEPN NGTPGTTTPL       300
     DPDHHLDPNK PDKATPVEIK PEPTAPKNPI LGLAENILGF FFPKPKPAIP EPSTPEHPGG       360
     TTTGTGTNNN SSKGDGGDSG DGGGDSAANS GNTGATTPST PATSNGEGPG SNGSSSTHEP       420
     PASTPTAGYP VDTLAKLATS EVYGPELEAV VAALQKEATG PTVSDVQAAQ KRLIEQGNQA       480
     PAVDAMVNIV ASMLAARDKQ ELAAAQQHLE DIAAKLGVPV ANLPKTDDMY LFPMSAAPTN       540
     PTHSPYERIR ELLTQITWHN SQTVQEAYDQ AKNRTYSSAE AEQARKDFRD QLRTSGYEAL       600
     LEMGYRPDAA DSLSKSIAEQ LMKKLVVTHN PDRIVGGRSD KMVTFGDSRT NSSIGNANQR       660
     GAAAYLAWLE VQMKKNPDAI VRFDFVEPDD PETPSTTPPG GTDD                        704
//

If you have problems or comments...

PBIL Back to PBIL home page