(data stored in ACNUC1104 zone)

EMBL: CP001966.PE232

CP001966.PE232       Location/Qualifiers
FT   CDS             248791..249426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0236"
FT                   /product="GAD-like domain protein"
FT                   /note="PFAM: GAD-like domain protein; KEGG: pst:PSPTO_2458
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76886"
FT                   /db_xref="InterPro:IPR014983"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ3"
FT                   /inference="protein motif:PFAM:PF08887"
FT                   /protein_id="ADG76886.1"
FT                   /translation="MTDDHFELFLRDVPLTTAGPACTQQHLDTYRGVLPNPLLSYWQEY
FT                   GFSGFGDGIVWLTDPLEWQATTTLITAGITHRPLGTDATYIPILRTAFGKIWFWTPGFG
FT                   RSLTITPAVGTASCIIQSAPRDLSLQATFATGDRERYDFDPKGFPGGLFEQVLTRCGPL
FT                   TVDQVYHFTPSIVSDDDPVDISTAQVANIHEWLAAVKTEVGDWSTFYI"
     MTDDHFELFL RDVPLTTAGP ACTQQHLDTY RGVLPNPLLS YWQEYGFSGF GDGIVWLTDP        60
     LEWQATTTLI TAGITHRPLG TDATYIPILR TAFGKIWFWT PGFGRSLTIT PAVGTASCII       120
     QSAPRDLSLQ ATFATGDRER YDFDPKGFPG GLFEQVLTRC GPLTVDQVYH FTPSIVSDDD       180
     PVDISTAQVA NIHEWLAAVK TEVGDWSTFY I                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page