(data stored in ACNUC1104 zone)

EMBL: CP001966.PE234

CP001966.PE234       Location/Qualifiers
FT   CDS             251269..251544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0238"
FT                   /product="prevent-host-death family protein"
FT                   /note="KEGG: lxx:Lxx22678 hypothetical protein; TIGRFAM:
FT                   prevent-host-death family protein; PFAM: protein of unknown
FT                   function DUF172"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76888"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ5"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADG76888.1"
FT                   /translation="MTTVPLGEAKDRLSALVDSAESTHDIITITRHGRAAAVLMSADDL
FT                   ESMQETIFWLSRPGTAAAIAEAEHDAAAGTASSGNDLRAEFGLTPR"
     MTTVPLGEAK DRLSALVDSA ESTHDIITIT RHGRAAAVLM SADDLESMQE TIFWLSRPGT        60
     AAAIAEAEHD AAAGTASSGN DLRAEFGLTP R                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page