(data stored in ACNUC1104 zone)

EMBL: CP001966.PE24

CP001966.PE24        Location/Qualifiers
FT   CDS             complement(25056..25457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76678"
FT                   /db_xref="GOA:D5UPC6"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76678.1"
FT                   /translation="MDNWSAPRSVGVVLLIAGIALGAATALGVIDDPVGIVLVGVGAVL
FT                   LCYLGASVLVLRPRLAADAAGVTYRGAFGRKHFPWDGLEIKRTSTKHWGRESVLLELTR
FT                   GDDLLFLGRWELGEAPTLVAQQLEELRPR"
     MDNWSAPRSV GVVLLIAGIA LGAATALGVI DDPVGIVLVG VGAVLLCYLG ASVLVLRPRL        60
     AADAAGVTYR GAFGRKHFPW DGLEIKRTST KHWGRESVLL ELTRGDDLLF LGRWELGEAP       120
     TLVAQQLEEL RPR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page