(data stored in ACNUC1104 zone)

EMBL: CP001966.PE240

CP001966.PE240       Location/Qualifiers
FT   CDS             complement(253736..255646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0244"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rop:ROP_61080 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76894"
FT                   /db_xref="GOA:D5UQR1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR1"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADG76894.1"
FT                   /translation="MLFWIRVAFRGNASTYRWVCIASGVCALAGANAVTIFLAASDTSS
FT                   VPEAPDINRYAKDLVAADGLTSFAAVMAVVSLVSAAMVIHALVGSVANARRDALAVYRI
FT                   LGATPRRAGMIFLLECAVFTAIGAAVGAGIGTLLAPPTRVMLAYYDLAPQTIAVGPRTS
FT                   AVALVFVLVTIAAMVGSRSGYRDVMTHADEKTQQRARRRRSIRPVPFALAVVFLAGAAA
FT                   LAALVPPTESAINSVPFGGALLGVIGAALLTPAVTYTFAAITTAISHGAMVPDRLSSYL
FT                   RIGGRWSATGASRSARIAIPITLAITVVAVIFSLAQTGRSASEYDKLKSVAAESVLDTS
FT                   AHPDRGWNVSATADPHSVGVRGDSRWTVPGQRPTVISLFRITHPENLATIFPGISPAAP
FT                   LALITASEQDRSSLRVLSGDPNDTVGDTHRWVSPDRQEVTVRVVGKVSENRYLRYRYLV
FT                   VDATFPDSPDTPGFVFYPTPADGPAVTTRQWVEDQIKENQRSQAAGITAIVAVPILLCA
FT                   IALLGVVMNIRRELLPGRLTLQQIGLTRSDTAAVFAVIAATSIAGALITAAVPLILTIY
FT                   SEQRIVHGIGYGIPIALPIAPVAATALSISLITLASMVIGWRAPKGRTHHTQIPMSVVA
FT                   D"
     MLFWIRVAFR GNASTYRWVC IASGVCALAG ANAVTIFLAA SDTSSVPEAP DINRYAKDLV        60
     AADGLTSFAA VMAVVSLVSA AMVIHALVGS VANARRDALA VYRILGATPR RAGMIFLLEC       120
     AVFTAIGAAV GAGIGTLLAP PTRVMLAYYD LAPQTIAVGP RTSAVALVFV LVTIAAMVGS       180
     RSGYRDVMTH ADEKTQQRAR RRRSIRPVPF ALAVVFLAGA AALAALVPPT ESAINSVPFG       240
     GALLGVIGAA LLTPAVTYTF AAITTAISHG AMVPDRLSSY LRIGGRWSAT GASRSARIAI       300
     PITLAITVVA VIFSLAQTGR SASEYDKLKS VAAESVLDTS AHPDRGWNVS ATADPHSVGV       360
     RGDSRWTVPG QRPTVISLFR ITHPENLATI FPGISPAAPL ALITASEQDR SSLRVLSGDP       420
     NDTVGDTHRW VSPDRQEVTV RVVGKVSENR YLRYRYLVVD ATFPDSPDTP GFVFYPTPAD       480
     GPAVTTRQWV EDQIKENQRS QAAGITAIVA VPILLCAIAL LGVVMNIRRE LLPGRLTLQQ       540
     IGLTRSDTAA VFAVIAATSI AGALITAAVP LILTIYSEQR IVHGIGYGIP IALPIAPVAA       600
     TALSISLITL ASMVIGWRAP KGRTHHTQIP MSVVAD                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page