(data stored in ACNUC1104 zone)

EMBL: CP001966.PE249

CP001966.PE249       Location/Qualifiers
FT   CDS             264528..267401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0253"
FT                   /product="TrwC relaxase"
FT                   /note="PFAM: TrwC relaxase; KEGG: car:cauri_pET4482726 TraA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76903"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS0"
FT                   /inference="protein motif:PFAM:PF08751"
FT                   /protein_id="ADG76903.1"
FT                   /translation="MLGRGERPVMTIHVLHAGDGYTYLTRNTASGDRVREGRDQLSAYY
FT                   LEGGTPPGRWHGRGLAALAAHSPASEHATGPVAGQVTEAQMKALFGEGLHPDADAMMKA
FT                   GASVKDVKLGNKFPVFANEIPVLVAFNTAVKEHEREHGAAPSKEVRDALWKQVARTEFE
FT                   RANPNEPGADDKRVLAWAAKEKGKVRQPVAGYDLTFTPVKSVSVMWALADPETRAKIET
FT                   AHQAAVGDALSWLEDNAVFTKRGARGEQQLSTAGLTVAQFDHYDTRAGDPNLHTHCAVS
FT                   NKVLGSDGRWGAINSLPFFNNAVAASQRYNAVLAETLRAELGVEFVARQVGRGKQPIME
FT                   IAGIDTALLDGFSTRRAQVRARHEQLLAQYIADHGHTPGKHAEYALFQQATLETREGKD
FT                   VGPEGSGSLGKQLTAWQSKARALAPEQAQGEQLLAQCRIAGREALAAISNDPDAAPDRA
FT                   WHGPAAAAEEVLHKVCEQRSVWRETHLRTAAEAIIAAKLLPSGSDRRELVDTVVERALA
FT                   ESMIVGPGHELLDTTTGEIPERLRRDNGEHVLTNPGGPLLTSSRIVDAENTILDAAATP
FT                   TAHVATNAVIDAGIASVEENEPFPLNAGQAELVRHFCGSGALVAAGVGPAGTGKTTSMK
FT                   ATVAAWTADANRLPGAAVNRQVIPLAPSAVAATKLGDEIELTGNTIDSFTYWWTAMGGR
FT                   ETYLTAHQVLADPDAGFLARRDARDALKRCPTGAMYLVDEAGMASTRNLAIMVDIAEQT
FT                   GGVVRFLGDPYQLDAVTTGGAFAMLARATDAPELTDVVRFGTDTQQAENSLALRAGDEA
FT                   ALDLYEQRGWTHHHNTAGEAIDEMVAAHLADTASGRNSIVLASTREEVAAINAQIQAHH
FT                   RSGGRAQAGRTVDLSDGLAAGVGDRIVTRDNDSDYRQIGGKRANSRVLNGDLWNVEKIH
FT                   SDGSLTARHIEDGGRIHLPASYLTANT"
     MLGRGERPVM TIHVLHAGDG YTYLTRNTAS GDRVREGRDQ LSAYYLEGGT PPGRWHGRGL        60
     AALAAHSPAS EHATGPVAGQ VTEAQMKALF GEGLHPDADA MMKAGASVKD VKLGNKFPVF       120
     ANEIPVLVAF NTAVKEHERE HGAAPSKEVR DALWKQVART EFERANPNEP GADDKRVLAW       180
     AAKEKGKVRQ PVAGYDLTFT PVKSVSVMWA LADPETRAKI ETAHQAAVGD ALSWLEDNAV       240
     FTKRGARGEQ QLSTAGLTVA QFDHYDTRAG DPNLHTHCAV SNKVLGSDGR WGAINSLPFF       300
     NNAVAASQRY NAVLAETLRA ELGVEFVARQ VGRGKQPIME IAGIDTALLD GFSTRRAQVR       360
     ARHEQLLAQY IADHGHTPGK HAEYALFQQA TLETREGKDV GPEGSGSLGK QLTAWQSKAR       420
     ALAPEQAQGE QLLAQCRIAG REALAAISND PDAAPDRAWH GPAAAAEEVL HKVCEQRSVW       480
     RETHLRTAAE AIIAAKLLPS GSDRRELVDT VVERALAESM IVGPGHELLD TTTGEIPERL       540
     RRDNGEHVLT NPGGPLLTSS RIVDAENTIL DAAATPTAHV ATNAVIDAGI ASVEENEPFP       600
     LNAGQAELVR HFCGSGALVA AGVGPAGTGK TTSMKATVAA WTADANRLPG AAVNRQVIPL       660
     APSAVAATKL GDEIELTGNT IDSFTYWWTA MGGRETYLTA HQVLADPDAG FLARRDARDA       720
     LKRCPTGAMY LVDEAGMAST RNLAIMVDIA EQTGGVVRFL GDPYQLDAVT TGGAFAMLAR       780
     ATDAPELTDV VRFGTDTQQA ENSLALRAGD EAALDLYEQR GWTHHHNTAG EAIDEMVAAH       840
     LADTASGRNS IVLASTREEV AAINAQIQAH HRSGGRAQAG RTVDLSDGLA AGVGDRIVTR       900
     DNDSDYRQIG GKRANSRVLN GDLWNVEKIH SDGSLTARHI EDGGRIHLPA SYLTANT          957
//

If you have problems or comments...

PBIL Back to PBIL home page