(data stored in ACNUC1104 zone)

EMBL: CP001966.PE252

CP001966.PE252       Location/Qualifiers
FT   CDS             268697..268810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76906"
FT                   /db_xref="GOA:D5UQS3"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76906.1"
FT                   /translation="MWPTNIAQVIVLALAGIVVTAAGSSLLVPQHIRGVLR"
     MWPTNIAQVI VLALAGIVVT AAGSSLLVPQ HIRGVLR                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page