(data stored in ACNUC1104 zone)

EMBL: CP001966.PE255

CP001966.PE255       Location/Qualifiers
FT   CDS             269742..270095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76909"
FT                   /db_xref="GOA:D5UQS6"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76909.1"
FT                   /translation="MTPPTEVAAECVRTYTPASWAICNAVQDGSLVRYLTVLMIAGVIA
FT                   AAVALLVTVAILVQVRRAQARLGRDGTGMSPREMSVAASRIRQLRGFTLDGLCATAGAL
FT                   IAVGLAAAMRSVL"
     MTPPTEVAAE CVRTYTPASW AICNAVQDGS LVRYLTVLMI AGVIAAAVAL LVTVAILVQV        60
     RRAQARLGRD GTGMSPREMS VAASRIRQLR GFTLDGLCAT AGALIAVGLA AAMRSVL          117
//

If you have problems or comments...

PBIL Back to PBIL home page