(data stored in ACNUC1104 zone)

EMBL: CP001966.PE256

CP001966.PE256       Location/Qualifiers
FT   CDS             270155..270730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76910"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76910.1"
FT                   /translation="MQGLNERSPDNGGEAVAAHLREVLDMLAAPALVREQVVFASSVRM
FT                   WPPRPGWDRTPGIGSIRLWTDCDLLAWFDAAAADGVALFGQQSRDEIRALTQATAMARM
FT                   CGEGAKAIWGLDVLGPGDYSPIPTSMKRVLWANDLVCFGPQLTEEQTAQIQAHLDDGHD
FT                   GHGRQETNAPVAVHGTECFATVWMGGTA"
     MQGLNERSPD NGGEAVAAHL REVLDMLAAP ALVREQVVFA SSVRMWPPRP GWDRTPGIGS        60
     IRLWTDCDLL AWFDAAAADG VALFGQQSRD EIRALTQATA MARMCGEGAK AIWGLDVLGP       120
     GDYSPIPTSM KRVLWANDLV CFGPQLTEEQ TAQIQAHLDD GHDGHGRQET NAPVAVHGTE       180
     CFATVWMGGT A                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page