(data stored in ACNUC1104 zone)

EMBL: CP001966.PE257

CP001966.PE257       Location/Qualifiers
FT   CDS             270787..271530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76911"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76911.1"
FT                   /translation="MGTKQSTKKGPSYAEINEKLVRKAIVDNRGELARLDSTTAIREWF
FT                   DAWVATVDTEPQFVWKLFLRELNKGVGVNSAELWAKEQAEHRAQVAEAARVAPLLRVCT
FT                   AGFVGETPDGETVASWAICNAQADQSSRAYGEINPDKQKSYDPEDPNSADMVAAYKAVA
FT                   LLADAVGYLGGEAGVIRAQLVISNPNIDTDRLVSMALKDSVSLTVEHHEEADNPAVEVC
FT                   ETEVGERHWKDLAPRDFVIEGEQGQ"
     MGTKQSTKKG PSYAEINEKL VRKAIVDNRG ELARLDSTTA IREWFDAWVA TVDTEPQFVW        60
     KLFLRELNKG VGVNSAELWA KEQAEHRAQV AEAARVAPLL RVCTAGFVGE TPDGETVASW       120
     AICNAQADQS SRAYGEINPD KQKSYDPEDP NSADMVAAYK AVALLADAVG YLGGEAGVIR       180
     AQLVISNPNI DTDRLVSMAL KDSVSLTVEH HEEADNPAVE VCETEVGERH WKDLAPRDFV       240
     IEGEQGQ                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page