(data stored in ACNUC1104 zone)

EMBL: CP001966.PE262

CP001966.PE262       Location/Qualifiers
FT   CDS             275068..275673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76916"
FT                   /db_xref="GOA:D5UQT3"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76916.1"
FT                   /translation="MARRRRESHRRLNLETGSDLILLSPRDATRYARNTQLRAAVAYPG
FT                   VFLLLFGLLAVTYAQVVSGFDPALGLVGVIGTVALAAGIGAALLVTFALRVTPVDDPLT
FT                   HAELDSYPGDVATTIRVGLAGLMPGGIGPGEYRPLAVARNRGLRRKYENGWDSVEIARV
FT                   QYRDAACPPGDRIPGLNRDQGEQRRLQVNPGTPTISED"
     MARRRRESHR RLNLETGSDL ILLSPRDATR YARNTQLRAA VAYPGVFLLL FGLLAVTYAQ        60
     VVSGFDPALG LVGVIGTVAL AAGIGAALLV TFALRVTPVD DPLTHAELDS YPGDVATTIR       120
     VGLAGLMPGG IGPGEYRPLA VARNRGLRRK YENGWDSVEI ARVQYRDAAC PPGDRIPGLN       180
     RDQGEQRRLQ VNPGTPTISE D                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page