(data stored in ACNUC1104 zone)

EMBL: CP001966.PE264

CP001966.PE264       Location/Qualifiers
FT   CDS             277087..277995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0268"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mva:Mvan_0583 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76918"
FT                   /db_xref="GOA:D5UQT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG76918.1"
FT                   /translation="MNRFQFVEDHKDAYGVKRLCQVIGIARSSFYAWLAAAQGRAARTA
FT                   ADSVLAGRIRVLQDPKQGGDRAYGAPRITADLNAGAAESERVNHKRVARVMREHGLAGI
FT                   RLRKRVKTTVPDQSGRRFPDLIGRNFSTGGPGRRYVGDITYLPIADGSNLYLASVIDLG
FT                   SRKLAGWSMATHMRTELVENALRAAQRERGTLAGAIFHSDHGSVYTSKAYTALCEHFGV
FT                   TQSMGAIGSSADNALAESFNATLKRELLQGRPAFGDQATAYRAVFRWANRYNTRRRHSA
FT                   IGNITPNTYETAYRATLTQAA"
     MNRFQFVEDH KDAYGVKRLC QVIGIARSSF YAWLAAAQGR AARTAADSVL AGRIRVLQDP        60
     KQGGDRAYGA PRITADLNAG AAESERVNHK RVARVMREHG LAGIRLRKRV KTTVPDQSGR       120
     RFPDLIGRNF STGGPGRRYV GDITYLPIAD GSNLYLASVI DLGSRKLAGW SMATHMRTEL       180
     VENALRAAQR ERGTLAGAIF HSDHGSVYTS KAYTALCEHF GVTQSMGAIG SSADNALAES       240
     FNATLKRELL QGRPAFGDQA TAYRAVFRWA NRYNTRRRHS AIGNITPNTY ETAYRATLTQ       300
     AA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page