(data stored in ACNUC1104 zone)

EMBL: CP001966.PE266

CP001966.PE266       Location/Qualifiers
FT   CDS             complement(280311..280439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76920"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76920.1"
FT                   /translation="MSEQDNGPQKRQSPTTWTVISLLVQAARLVVDLVRLIRDSVI"
     MSEQDNGPQK RQSPTTWTVI SLLVQAARLV VDLVRLIRDS VI                           42
//

If you have problems or comments...

PBIL Back to PBIL home page