(data stored in ACNUC1104 zone)

EMBL: CP001966.PE27

CP001966.PE27        Location/Qualifiers
FT   CDS             complement(26548..28542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0027"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: rer:RER_00280 serine/threonine protein kinase
FT                   PknB; PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76681"
FT                   /db_xref="GOA:D5UPC9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG76681.1"
FT                   /translation="MTTPPRRINDRYDLGETLGFGGMSEVHLARDTRLSRDVAIKILRA
FT                   DLARDPSFYERFRREAQNAASLNHPTIVQVYDTGEADTPGGPLPYIVMEYVDGETLRDV
FT                   LRRDGTIAPQAAMTWMADVCAALDFSHRNGIVHRDMKPANVMLTRTGEIKVMDFGIARA
FT                   MSDPSAGMTQTAAVIGTAQYLSPEQARGESVDARSDVYAAGCVLFELLTGQPPFQGDSP
FT                   VSVAYQHVREDPPTPSSILDTVPPELDSITLKALSKNPANRYQTAGEMRQDLIRVLAGR
FT                   KPEAPMVLSDEERDALLTEPTKPRRAAKAAPAAAAAAAAVPAAAAGTPGEPTGDDDRPT
FT                   EAVATVPAASGRAKHSTASGGRSRLVLWISAAIIAIILVGGTTAYLLAGPDEAKQVTVP
FT                   SQIGQNASDAQVALQKLGFNVQIKRVPDNTVPAEQVISTIPGPDSQATEGSTVIVEVSS
FT                   GPKIAAVPDVVNRSEKDARDILTKAGFTVAKDPKKEASPTVKAGDVVSTNPAVGANTPQ
FT                   NTPIVLTVSTGKEQVRVPDVSNTALSQAEANLKGLGFTTKVQEVDDPAPAGTVLRTTPA
FT                   GGTTADKGSDITIVVSKAKAVVMPNLVGQDPSAAKAALIAMGFSESNIQVMATAPSNLP
FT                   WDKNKVWKTTPDAGARVDTSASITIEVRR"
     MTTPPRRIND RYDLGETLGF GGMSEVHLAR DTRLSRDVAI KILRADLARD PSFYERFRRE        60
     AQNAASLNHP TIVQVYDTGE ADTPGGPLPY IVMEYVDGET LRDVLRRDGT IAPQAAMTWM       120
     ADVCAALDFS HRNGIVHRDM KPANVMLTRT GEIKVMDFGI ARAMSDPSAG MTQTAAVIGT       180
     AQYLSPEQAR GESVDARSDV YAAGCVLFEL LTGQPPFQGD SPVSVAYQHV REDPPTPSSI       240
     LDTVPPELDS ITLKALSKNP ANRYQTAGEM RQDLIRVLAG RKPEAPMVLS DEERDALLTE       300
     PTKPRRAAKA APAAAAAAAA VPAAAAGTPG EPTGDDDRPT EAVATVPAAS GRAKHSTASG       360
     GRSRLVLWIS AAIIAIILVG GTTAYLLAGP DEAKQVTVPS QIGQNASDAQ VALQKLGFNV       420
     QIKRVPDNTV PAEQVISTIP GPDSQATEGS TVIVEVSSGP KIAAVPDVVN RSEKDARDIL       480
     TKAGFTVAKD PKKEASPTVK AGDVVSTNPA VGANTPQNTP IVLTVSTGKE QVRVPDVSNT       540
     ALSQAEANLK GLGFTTKVQE VDDPAPAGTV LRTTPAGGTT ADKGSDITIV VSKAKAVVMP       600
     NLVGQDPSAA KAALIAMGFS ESNIQVMATA PSNLPWDKNK VWKTTPDAGA RVDTSASITI       660
     EVRR                                                                    664
//

If you have problems or comments...

PBIL Back to PBIL home page