(data stored in ACNUC1104 zone)

EMBL: CP001966.PE270

CP001966.PE270       Location/Qualifiers
FT   CDS             complement(283780..285885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_4254 kinetoplast DNA-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76924"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76924.1"
FT                   /translation="MTVCRALINPASANLRGLYVALTRGKAENHAYTATPATIDEHTED
FT                   QHLHGAGDERAADNSRAILAVVLAKDDGHKAAVEHIQEALAASTDPQTARDAYTAARDL
FT                   LVADYTDHLLAAHLPAAIVATIDADPAGKARIRSVVDQLIASGASSTVIGARLNAVHDG
FT                   LETARNLPAFIAYKINPPASAVAAQEHRAARELFVRDYTDHLLATHLPAAVVATIDADP
FT                   DSRRSIENAVDRLHAAGATDIPARFADADTRLENLSPGASYTAHLLRSLRRPTHANEQA
FT                   DPSPAQIAAHLHADPAGNAQLNAALTALAPLPDLTPEPDPADLPALPPAHPGADRSLRE
FT                   HAHHAVDSHDRATADQLAIDRPADTEPEAAQPVAAALTTEQLLAAETTPALAPGLDPAT
FT                   LAAAARAVDEATRGPDTEPATEPAETAPDTEAPADPAAAERKALAARTVAEFKQHSIRR
FT                   LPASELDYIARTGGRKHADRLRELRHHTPREVAEHEASAQRLALYERSYAREQPYRDAI
FT                   TAHRKAIDALDTARTKRDAVARELADTGRLSPRRRELARELDTRTAAVTAAEKAAEDAR
FT                   RTRSQEQARAGKHPVTDGALQAAREHTENARAEAEKAQARQQAKIAELTATITARQQAA
FT                   LTEQERRSQLDPTQLKIEQKLRGAALEHAQQQAQQRKDAARARAGRFANDPARPVSRGV
FT                   DGPTRGR"
     MTVCRALINP ASANLRGLYV ALTRGKAENH AYTATPATID EHTEDQHLHG AGDERAADNS        60
     RAILAVVLAK DDGHKAAVEH IQEALAASTD PQTARDAYTA ARDLLVADYT DHLLAAHLPA       120
     AIVATIDADP AGKARIRSVV DQLIASGASS TVIGARLNAV HDGLETARNL PAFIAYKINP       180
     PASAVAAQEH RAARELFVRD YTDHLLATHL PAAVVATIDA DPDSRRSIEN AVDRLHAAGA       240
     TDIPARFADA DTRLENLSPG ASYTAHLLRS LRRPTHANEQ ADPSPAQIAA HLHADPAGNA       300
     QLNAALTALA PLPDLTPEPD PADLPALPPA HPGADRSLRE HAHHAVDSHD RATADQLAID       360
     RPADTEPEAA QPVAAALTTE QLLAAETTPA LAPGLDPATL AAAARAVDEA TRGPDTEPAT       420
     EPAETAPDTE APADPAAAER KALAARTVAE FKQHSIRRLP ASELDYIART GGRKHADRLR       480
     ELRHHTPREV AEHEASAQRL ALYERSYARE QPYRDAITAH RKAIDALDTA RTKRDAVARE       540
     LADTGRLSPR RRELARELDT RTAAVTAAEK AAEDARRTRS QEQARAGKHP VTDGALQAAR       600
     EHTENARAEA EKAQARQQAK IAELTATITA RQQAALTEQE RRSQLDPTQL KIEQKLRGAA       660
     LEHAQQQAQQ RKDAARARAG RFANDPARPV SRGVDGPTRG R                           701
//

If you have problems or comments...

PBIL Back to PBIL home page