(data stored in ACNUC1104 zone)

EMBL: CP001966.PE273

CP001966.PE273       Location/Qualifiers
FT   CDS             287267..287596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0278"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   nca:Noca_2153 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76927"
FT                   /db_xref="GOA:D5UQT9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT9"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76927.1"
FT                   /translation="MARKSYTDEFRCRAVDLYESTPGATLQGIAADLGVSRGSLKGWVD
FT                   KLGSGTRTASAAAGVSVGRRESQAARITRLEAENGVLRVEQAKLAEERDILRQAAKYFA
FT                   GETSW"
     MARKSYTDEF RCRAVDLYES TPGATLQGIA ADLGVSRGSL KGWVDKLGSG TRTASAAAGV        60
     SVGRRESQAA RITRLEAENG VLRVEQAKLA EERDILRQAA KYFAGETSW                   109
//

If you have problems or comments...

PBIL Back to PBIL home page