(data stored in ACNUC1104 zone)

EMBL: CP001966.PE275

CP001966.PE275       Location/Qualifiers
FT   CDS             288586..289368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0280"
FT                   /product="F420-dependent oxidoreductase, G6PDH family"
FT                   /note="KEGG: mva:Mvan_5448 luciferase family protein;
FT                   TIGRFAM: F420-dependent oxidoreductase, G6PDH family; PFAM:
FT                   Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76929"
FT                   /db_xref="GOA:D5UQU6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU6"
FT                   /inference="protein motif:TFAM:TIGR03557"
FT                   /protein_id="ADG76929.1"
FT                   /translation="MDMRFGYTLMTEQAGPAQLVRDAVAAEEAGFDFEVSSDHYSPWLL
FT                   AQGHAPYAWSVLGAVAHVTSRVDLMTYVTCPTIRYHPAVVAQKAATMQLLADGRFTLGL
FT                   GSGENLNEHVVGEGWPGIRDRQAMLSEAIEIIRKLHAGGTVDFRGEYFQVDSARIWDLP
FT                   DNGVPIGVAVSGDRGVSEFATLADHLISTDPRRSLVEKWNANPGTTLIGQGARAIGQLP
FT                   ICWDREKNAAIERAHGLFRWFAGGWGVNADLPTPRACC"
     MDMRFGYTLM TEQAGPAQLV RDAVAAEEAG FDFEVSSDHY SPWLLAQGHA PYAWSVLGAV        60
     AHVTSRVDLM TYVTCPTIRY HPAVVAQKAA TMQLLADGRF TLGLGSGENL NEHVVGEGWP       120
     GIRDRQAMLS EAIEIIRKLH AGGTVDFRGE YFQVDSARIW DLPDNGVPIG VAVSGDRGVS       180
     EFATLADHLI STDPRRSLVE KWNANPGTTL IGQGARAIGQ LPICWDREKN AAIERAHGLF       240
     RWFAGGWGVN ADLPTPRACC                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page