(data stored in ACNUC1104 zone)

EMBL: CP001966.PE276

CP001966.PE276       Location/Qualifiers
FT   CDS             complement(290280..290714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0282"
FT                   /product="protein of unknown function UCP032285"
FT                   /note="PFAM: protein of unknown function UCP032285; KEGG:
FT                   cgb:cg1510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76930"
FT                   /db_xref="InterPro:IPR011235"
FT                   /db_xref="InterPro:IPR038231"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU7"
FT                   /inference="protein motif:PFAM:PF08877"
FT                   /protein_id="ADG76930.1"
FT                   /translation="MGFSAFRVWASKFGLTVSVEPEAQNSDYESGVAQIAGREWHVRTA
FT                   RNTPTKPGAFVAFWRRGMDGQTLPFSVERLDAGLLVFVESEGRRGVFKFSASHLAELGI
FT                   ASASDRGGKRGFRVYPSWCEGLNPQARATQRAQAPAFDEY"
     MGFSAFRVWA SKFGLTVSVE PEAQNSDYES GVAQIAGREW HVRTARNTPT KPGAFVAFWR        60
     RGMDGQTLPF SVERLDAGLL VFVESEGRRG VFKFSASHLA ELGIASASDR GGKRGFRVYP       120
     SWCEGLNPQA RATQRAQAPA FDEY                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page