(data stored in ACNUC1104 zone)

EMBL: CP001966.PE279

CP001966.PE279       Location/Qualifiers
FT   CDS             complement(294186..294719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_1242c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76933"
FT                   /db_xref="GOA:D5UQV0"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV0"
FT                   /inference="similar to AA sequence:KEGG:MAB_1242c"
FT                   /protein_id="ADG76933.1"
FT                   /translation="MRSSTRLVDRFITLLTGLVLLGIGGWLLAYRLGERHIVSASQRLI
FT                   PDKIADTPDSPWWNPAVGIAGVALVLLALWLLLQHLRTNTAKTVATAHGGTVDLTKVAT
FT                   AVAEDLSTSPLIRKARSTTIQHKDQPTIQVRVTIAPGAPVQELAELARAAQTEVTAATN
FT                   PDIGLQLLVDSEDK"
     MRSSTRLVDR FITLLTGLVL LGIGGWLLAY RLGERHIVSA SQRLIPDKIA DTPDSPWWNP        60
     AVGIAGVALV LLALWLLLQH LRTNTAKTVA TAHGGTVDLT KVATAVAEDL STSPLIRKAR       120
     STTIQHKDQP TIQVRVTIAP GAPVQELAEL ARAAQTEVTA ATNPDIGLQL LVDSEDK          177
//

If you have problems or comments...

PBIL Back to PBIL home page