(data stored in ACNUC1104 zone)

EMBL: CP001966.PE288

CP001966.PE288       Location/Qualifiers
FT   CDS             301832..302647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0296"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: rop:ROP_07010
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76942"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV9"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADG76942.1"
FT                   /translation="MIRRIARALLGSYFIYSGANTLLRPGETAHAAAGVVHKAQETFPE
FT                   APLPASPAAWARALGGVQLSAGTLLALDRLPRLSALTLAGSLAAATATENRFWSESDPG
FT                   IREEATVHFLKNISLIGGLVIVGLDTEGEPGVVWRTKRAGRRAADRAAAAVAVLNPAAD
FT                   NGSDTKNLAAELQEKAHDTAEKLGDRLADTREVIERNIAHAGEMAAPVASTLAQAAGTQ
FT                   AARLSTAASETLTDLREHAPAYAEQVRDNAQRLVATAQDHTPAVRQPQA"
     MIRRIARALL GSYFIYSGAN TLLRPGETAH AAAGVVHKAQ ETFPEAPLPA SPAAWARALG        60
     GVQLSAGTLL ALDRLPRLSA LTLAGSLAAA TATENRFWSE SDPGIREEAT VHFLKNISLI       120
     GGLVIVGLDT EGEPGVVWRT KRAGRRAADR AAAAVAVLNP AADNGSDTKN LAAELQEKAH       180
     DTAEKLGDRL ADTREVIERN IAHAGEMAAP VASTLAQAAG TQAARLSTAA SETLTDLREH       240
     APAYAEQVRD NAQRLVATAQ DHTPAVRQPQ A                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page