(data stored in ACNUC1104 zone)

EMBL: CP001966.PE289

CP001966.PE289       Location/Qualifiers
FT   CDS             complement(302887..304365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0297"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   nfa:nfa30230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76943"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW0"
FT                   /inference="protein motif:PFAM:PF00668"
FT                   /protein_id="ADG76943.1"
FT                   /translation="MISGFAEHWQCPTGEWVVWAPDANTCEAMRNAPDLGVETSFIQAD
FT                   HLRSGIEGESCVRRLVFTSFTVHDKFDAETIAKVFTDFVRAHETFHTAFPVSTDLRPRG
FT                   RTLRPEQISLAVTARSQDHPERTVKDHLIESVPTLHEWAAFAFAVNGIENAGPDAVDPH
FT                   FQVVVGSDHMFTDGVSQAISFFEILSRYTAARTGTPYEPVPVRPYPQFCAEQRALAATL
FT                   TPTHPDVEQWRDTLARAGGMPKFPLPLGLGPGEAAPGKIAVHASFVDAAQAARFGAAAK
FT                   QAGGNTSSALLAVLGQVHHALTGERLFTMLIPRADRSATGDAMAVGWYVTLVPVQFDAS
FT                   GTFAEATRNAQEALGVARQLDRTPVFPVIDMLANDPGFPVQHGFTSPMLSYIDVTRVPG
FT                   AELARQHDFSVFANATPSREVFMWINRDESGLDFNAQHPETVEATRAVDTVFRLLRDRI
FT                   IEVGKALGLRETGLSTVSVDSSGSSANGIAPGQL"
     MISGFAEHWQ CPTGEWVVWA PDANTCEAMR NAPDLGVETS FIQADHLRSG IEGESCVRRL        60
     VFTSFTVHDK FDAETIAKVF TDFVRAHETF HTAFPVSTDL RPRGRTLRPE QISLAVTARS       120
     QDHPERTVKD HLIESVPTLH EWAAFAFAVN GIENAGPDAV DPHFQVVVGS DHMFTDGVSQ       180
     AISFFEILSR YTAARTGTPY EPVPVRPYPQ FCAEQRALAA TLTPTHPDVE QWRDTLARAG       240
     GMPKFPLPLG LGPGEAAPGK IAVHASFVDA AQAARFGAAA KQAGGNTSSA LLAVLGQVHH       300
     ALTGERLFTM LIPRADRSAT GDAMAVGWYV TLVPVQFDAS GTFAEATRNA QEALGVARQL       360
     DRTPVFPVID MLANDPGFPV QHGFTSPMLS YIDVTRVPGA ELARQHDFSV FANATPSREV       420
     FMWINRDESG LDFNAQHPET VEATRAVDTV FRLLRDRIIE VGKALGLRET GLSTVSVDSS       480
     GSSANGIAPG QL                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page