(data stored in ACNUC1104 zone)

EMBL: CP001966.PE296

CP001966.PE296       Location/Qualifiers
FT   CDS             309871..311073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76950"
FT                   /db_xref="GOA:D5UQW7"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76950.1"
FT                   /translation="MCWITRVQEQGVRPSLCNDARTSPVQMPRSSNSEVNRIAGFVWRM
FT                   PGIFDRDRDLTSSSGRRAVFPGVVPIIVAAVVVGVALILGAVSVSHRAPNGNRDDVVAA
FT                   EQKVHETQMRLDAALLGGLSEVQSVAAPAVGKAVDWQRDVTTVLGRRSELRSVYAVANR
FT                   DGSVLARAGNTPSRIAGGTRIEPPAGGFGLLQASTSGAEPIILAIALSHDQSVTVVAEF
FT                   EPRKLNSLLMRFAGDSVVLGRTGKVILSSKGYRAFSMPGAETARLGGEATSVPFATILG
FT                   SGDDAAVLASERVGGQGPVSDLLWVVVQRTPVKPAIFSLPVSKRAALVAFGLIGLSTGA
FT                   LLLWLYASTTVPLRKVIAWLELVVHDHGAATPPLAPAPRRFDEVGALTSGLLYLVKRGP
FT                   R"
     MCWITRVQEQ GVRPSLCNDA RTSPVQMPRS SNSEVNRIAG FVWRMPGIFD RDRDLTSSSG        60
     RRAVFPGVVP IIVAAVVVGV ALILGAVSVS HRAPNGNRDD VVAAEQKVHE TQMRLDAALL       120
     GGLSEVQSVA APAVGKAVDW QRDVTTVLGR RSELRSVYAV ANRDGSVLAR AGNTPSRIAG       180
     GTRIEPPAGG FGLLQASTSG AEPIILAIAL SHDQSVTVVA EFEPRKLNSL LMRFAGDSVV       240
     LGRTGKVILS SKGYRAFSMP GAETARLGGE ATSVPFATIL GSGDDAAVLA SERVGGQGPV       300
     SDLLWVVVQR TPVKPAIFSL PVSKRAALVA FGLIGLSTGA LLLWLYASTT VPLRKVIAWL       360
     ELVVHDHGAA TPPLAPAPRR FDEVGALTSG LLYLVKRGPR                             400
//

If you have problems or comments...

PBIL Back to PBIL home page