(data stored in ACNUC1104 zone)

EMBL: CP001966.PE297

CP001966.PE297       Location/Qualifiers
FT   CDS             311070..312260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0305"
FT                   /product="Mur ligase middle domain protein"
FT                   /note="PFAM: Mur ligase middle domain protein; KEGG:
FT                   dsy:DSY4395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76951"
FT                   /db_xref="GOA:D5UQW8"
FT                   /db_xref="InterPro:IPR008337"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW8"
FT                   /inference="protein motif:PFAM:PF08245"
FT                   /protein_id="ADG76951.1"
FT                   /translation="MIVLYALVVSACLALLGCGVLEQYRHHRNLHSIPIRVVVNGIRGK
FT                   SSITRLCAGALRGGGLVTVAKTTGTAARFIPPDGVDEQIHRRFGLANVIEQVGIVRRAA
FT                   SFRPDALVIECMAVLPDLQEINERKLIHSTICVICNVREDHVDEMGPTLEDIARSLSRS
FT                   MPEGGVCITAEKEYVHILREEARKRGCRLVEVESDDIGDEILAEFPFITFKENIAIALA
FT                   VAELCGVDYRAALRGMIESPADPGTVAVKEYRYRGTVITVANLFAANDPESTRMNVELL
FT                   TARGLIGRPLNVIVNCRPDRVERNGQMGALTSALDPERIILIGEPTRSARVTVPDQLAV
FT                   RIADLGGRLDFDRVLAAIASDDDGEASVVTIGNIHGNGEILLHAFETLDHNPLEAP"
     MIVLYALVVS ACLALLGCGV LEQYRHHRNL HSIPIRVVVN GIRGKSSITR LCAGALRGGG        60
     LVTVAKTTGT AARFIPPDGV DEQIHRRFGL ANVIEQVGIV RRAASFRPDA LVIECMAVLP       120
     DLQEINERKL IHSTICVICN VREDHVDEMG PTLEDIARSL SRSMPEGGVC ITAEKEYVHI       180
     LREEARKRGC RLVEVESDDI GDEILAEFPF ITFKENIAIA LAVAELCGVD YRAALRGMIE       240
     SPADPGTVAV KEYRYRGTVI TVANLFAAND PESTRMNVEL LTARGLIGRP LNVIVNCRPD       300
     RVERNGQMGA LTSALDPERI ILIGEPTRSA RVTVPDQLAV RIADLGGRLD FDRVLAAIAS       360
     DDDGEASVVT IGNIHGNGEI LLHAFETLDH NPLEAP                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page