(data stored in ACNUC1104 zone)

EMBL: CP001966.PE299

CP001966.PE299       Location/Qualifiers
FT   CDS             312736..313752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4672 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76953"
FT                   /db_xref="GOA:D5URA0"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76953.1"
FT                   /translation="MIRLDLRELSARGRRLAVLCFVFVIIGGTGIGIGTARVYSRANST
FT                   EAVELLPAFSTLHFERLADPARTLARDDRGRVVAIMTDGARTVVLAGRLRTFVEPETTA
FT                   AIVASNARVLLLPRSWSAGGEGDTWFSTWYLAARETSVDLLEAATQYLTGADSDFDARG
FT                   IEYRGDAHYPGVSATGERVPGDFNDYLGVAWTFSDGATRQAPPTRSRALSSAGLVRLVF
FT                   GYRGGMPLSGHVRDPSGMAPTVDELFYGAGATIAPVTGAAVSDLGRLQPGDLLFFDTDP
FT                   DATLDQVAIYLGVDQRSEHRFIMSRREADGPTMGDTGGRSVVDRGRFASALRAVKRI"
     MIRLDLRELS ARGRRLAVLC FVFVIIGGTG IGIGTARVYS RANSTEAVEL LPAFSTLHFE        60
     RLADPARTLA RDDRGRVVAI MTDGARTVVL AGRLRTFVEP ETTAAIVASN ARVLLLPRSW       120
     SAGGEGDTWF STWYLAARET SVDLLEAATQ YLTGADSDFD ARGIEYRGDA HYPGVSATGE       180
     RVPGDFNDYL GVAWTFSDGA TRQAPPTRSR ALSSAGLVRL VFGYRGGMPL SGHVRDPSGM       240
     APTVDELFYG AGATIAPVTG AAVSDLGRLQ PGDLLFFDTD PDATLDQVAI YLGVDQRSEH       300
     RFIMSRREAD GPTMGDTGGR SVVDRGRFAS ALRAVKRI                               338
//

If you have problems or comments...

PBIL Back to PBIL home page