(data stored in ACNUC1104 zone)

EMBL: CP001966.PE302

CP001966.PE302       Location/Qualifiers
FT   CDS             315830..316759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0310"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: sco:SCO3245
FT                   salicylate hydroxylase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76956"
FT                   /db_xref="GOA:D5URA3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA3"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADG76956.1"
FT                   /translation="MIGTSTVEVAVVGGGIGGLSAAVSLMSVGIDATVYERAPELGEVG
FT                   AGVSLQPNALRVYEQIGILDDIKDIGSPMNRTLYLTAGGALVEQEGYTGIGVYRPDLIE
FT                   VLKSKLPPENIKLGKQAIGYTESGNKALVEFADNTTELADVVIAADGIRSTLRRSLNSD
FT                   NDGFVFSGLMAYRGVLPTSAVPDFPAEAAIDWMGGGRFIRAYRLRNGQLLNWIAVVPTD
FT                   NIFSENWTLPGNPDELRKEFPSKNWDPLAINILKQVQTTARYALFDRDPILEWHRDRVV
FT                   LLGDAAHPMLPHDRAGRKLCNRRRDCDR"
     MIGTSTVEVA VVGGGIGGLS AAVSLMSVGI DATVYERAPE LGEVGAGVSL QPNALRVYEQ        60
     IGILDDIKDI GSPMNRTLYL TAGGALVEQE GYTGIGVYRP DLIEVLKSKL PPENIKLGKQ       120
     AIGYTESGNK ALVEFADNTT ELADVVIAAD GIRSTLRRSL NSDNDGFVFS GLMAYRGVLP       180
     TSAVPDFPAE AAIDWMGGGR FIRAYRLRNG QLLNWIAVVP TDNIFSENWT LPGNPDELRK       240
     EFPSKNWDPL AINILKQVQT TARYALFDRD PILEWHRDRV VLLGDAAHPM LPHDRAGRKL       300
     CNRRRDCDR                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page