(data stored in ACNUC1104 zone)

EMBL: CP001966.PE305

CP001966.PE305       Location/Qualifiers
FT   CDS             320206..320835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0313"
FT                   /product="Lipoprotein LpqT, predicted"
FT                   /note="PFAM: Lipoprotein LpqT, predicted; KEGG:
FT                   mjl:Mjls_5766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76959"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA6"
FT                   /inference="protein motif:PFAM:PF10738"
FT                   /protein_id="ADG76959.1"
FT                   /translation="MRRTLFALLTTAAVLVAAGCSGSSDEAPATTTTAATDMTLDEYLK
FT                   SHGVAVVAQTAADLKGVRIAVQQPPNWFVDSAFQLPNTFAVIADTRATSEGFTPNATVL
FT                   VHRLTGDIDPAEAIRRGPVDTTRYPGFRQDSVQIGTRDGDPSSTIRGSYDDGKGRRLAV
FT                   SSTYVIHSGAQQRLAVQLLVTTTEKQAQTLRGDVQTLVDGLKITDV"
     MRRTLFALLT TAAVLVAAGC SGSSDEAPAT TTTAATDMTL DEYLKSHGVA VVAQTAADLK        60
     GVRIAVQQPP NWFVDSAFQL PNTFAVIADT RATSEGFTPN ATVLVHRLTG DIDPAEAIRR       120
     GPVDTTRYPG FRQDSVQIGT RDGDPSSTIR GSYDDGKGRR LAVSSTYVIH SGAQQRLAVQ       180
     LLVTTTEKQA QTLRGDVQTL VDGLKITDV                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page