(data stored in ACNUC1104 zone)

EMBL: CP001966.PE306

CP001966.PE306       Location/Qualifiers
FT   CDS             complement(322162..323295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76960"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA7"
FT                   /inference="similar to AA sequence:KEGG:CNBK0040"
FT                   /protein_id="ADG76960.1"
FT                   /translation="MEQNTLKRRGAGLIGRDAERSAGGYTLYAPLSGDGAVYLVDEDGA
FT                   EVHRWNLPYRPGRHARLLADGSLAYNGNLVGSGEGPALFDMWRKYSGGSMARYDRDGKM
FT                   LSEVVDPLQHHDAHHLDDGRILYAALEPLTGNRARAVRGGHPGTEAAGPDGTPTVYADT
FT                   IQEVGPDGELLWSWNAFDHLDVLDFPLQAHYWREHWPLINSVQPLGDDAVVASLRSVSA
FT                   VVVIDRATGDVRTVADPETVAQQHHVTPLDSGTLLVFDNGTFRHGESVTYSRVIELDPA
FT                   DGSVVWQYADNPREAFFTPFMGGAQRLWNGNTLITEAAFGRLFEVTAEGRVVWEFVVPQ
FT                   FSAYPDPSTRTVFPAVGNAVFRAYRYPAEQVQAWGLA"
     MEQNTLKRRG AGLIGRDAER SAGGYTLYAP LSGDGAVYLV DEDGAEVHRW NLPYRPGRHA        60
     RLLADGSLAY NGNLVGSGEG PALFDMWRKY SGGSMARYDR DGKMLSEVVD PLQHHDAHHL       120
     DDGRILYAAL EPLTGNRARA VRGGHPGTEA AGPDGTPTVY ADTIQEVGPD GELLWSWNAF       180
     DHLDVLDFPL QAHYWREHWP LINSVQPLGD DAVVASLRSV SAVVVIDRAT GDVRTVADPE       240
     TVAQQHHVTP LDSGTLLVFD NGTFRHGESV TYSRVIELDP ADGSVVWQYA DNPREAFFTP       300
     FMGGAQRLWN GNTLITEAAF GRLFEVTAEG RVVWEFVVPQ FSAYPDPSTR TVFPAVGNAV       360
     FRAYRYPAEQ VQAWGLA                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page