(data stored in ACNUC1104 zone)

EMBL: CP001966.PE308

CP001966.PE308       Location/Qualifiers
FT   CDS             complement(324996..325427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0317"
FT                   /product="regulatory protein ArsR"
FT                   /note="SMART: regulatory protein ArsR; KEGG:
FT                   rha:RHA1_ro04775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76962"
FT                   /db_xref="GOA:D5URA9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA9"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ADG76962.1"
FT                   /translation="MSSESSSDLQEVNARLEAIEQRLHALEASGDAKIVSSLRTPPDDA
FT                   ASSTELPLVRISNFFSAIGNPTRLSIIRALAEGAKTPAEILSAVEIESKGKMYHHLRTL
FT                   TGTSILARTAGGAYQISSDYMARVIAEMSAVALEVTASH"
     MSSESSSDLQ EVNARLEAIE QRLHALEASG DAKIVSSLRT PPDDAASSTE LPLVRISNFF        60
     SAIGNPTRLS IIRALAEGAK TPAEILSAVE IESKGKMYHH LRTLTGTSIL ARTAGGAYQI       120
     SSDYMARVIA EMSAVALEVT ASH                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page