(data stored in ACNUC1104 zone)

EMBL: CP001966.PE309

CP001966.PE309       Location/Qualifiers
FT   CDS             complement(325435..326004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_1516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76963"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76963.1"
FT                   /translation="MITFILASLLSMTVFSQHPLRAFDRLRKADRNGLVLPDWRFFAPD
FT                   PIRYDFALLFRTGTGSDNVTEWQFAQPATCSRQWRHGLWYPEQRLNKALLDVCQSALKS
FT                   LRNTNPGSAEAPLLILRSLAEISARQTSPSEQLSENMKYPYISTEKMQFAITRYGGFDS
FT                   KARMEVLYVSEASALWKNRIAKSDRS"
     MITFILASLL SMTVFSQHPL RAFDRLRKAD RNGLVLPDWR FFAPDPIRYD FALLFRTGTG        60
     SDNVTEWQFA QPATCSRQWR HGLWYPEQRL NKALLDVCQS ALKSLRNTNP GSAEAPLLIL       120
     RSLAEISARQ TSPSEQLSEN MKYPYISTEK MQFAITRYGG FDSKARMEVL YVSEASALWK       180
     NRIAKSDRS                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page