(data stored in ACNUC1104 zone)

EMBL: CP001966.PE313

CP001966.PE313       Location/Qualifiers
FT   CDS             330247..331533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0323"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; MULE transposase,
FT                   conserved domain; KEGG: mul:MUL_4727 transposase for
FT                   IS2606"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76967"
FT                   /db_xref="GOA:D5UR87"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5UR87"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADG76967.1"
FT                   /translation="MTETLHVMDDGRQPTEQELQLARELVAQAREQGASMSAPGMLRAL
FT                   TKTMLETALDEEITEHLGYDKHHIEGRGSGNSRNGARTKTVITETVGPIEIEVPRDREG
FT                   SFDPKIVAKHQRRLNGVDEIVLSLAARGLTSGDIVAHFDQIYGASISKDTISRITDKIV
FT                   EEMTGWFNRPLEPIYVAVFIDALHIKVRDGQVANRPFYAAIGVDLDGHKDVLGIWAGEG
FT                   GGESAKFWYAVLSSLKSRGVNDVFFLVCDGLKGLPASVAAVWPETIVQTCVIHLLRNSF
FT                   KYVPRQHWDTLKRDLKPIYTAIDATAAEAALDALDDTWGQKYPTMIRLWRNAWDEFIPF
FT                   LDYNIEVRRVLYSTNAIESLNARYRRAVKARGHFPTEQAALKTLYLVTRALDPSGRGQN
FT                   RWAARWKPALNAFAITFADRIPGLNRDQG"
     MTETLHVMDD GRQPTEQELQ LARELVAQAR EQGASMSAPG MLRALTKTML ETALDEEITE        60
     HLGYDKHHIE GRGSGNSRNG ARTKTVITET VGPIEIEVPR DREGSFDPKI VAKHQRRLNG       120
     VDEIVLSLAA RGLTSGDIVA HFDQIYGASI SKDTISRITD KIVEEMTGWF NRPLEPIYVA       180
     VFIDALHIKV RDGQVANRPF YAAIGVDLDG HKDVLGIWAG EGGGESAKFW YAVLSSLKSR       240
     GVNDVFFLVC DGLKGLPASV AAVWPETIVQ TCVIHLLRNS FKYVPRQHWD TLKRDLKPIY       300
     TAIDATAAEA ALDALDDTWG QKYPTMIRLW RNAWDEFIPF LDYNIEVRRV LYSTNAIESL       360
     NARYRRAVKA RGHFPTEQAA LKTLYLVTRA LDPSGRGQNR WAARWKPALN AFAITFADRI       420
     PGLNRDQG                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page