(data stored in ACNUC1104 zone)

EMBL: CP001966.PE315

CP001966.PE315       Location/Qualifiers
FT   CDS             336938..337228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0326"
FT                   /product="PE domain protein"
FT                   /note="PFAM: PE domain protein; KEGG: mgi:Mflv_5460 PE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76969"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB6"
FT                   /inference="protein motif:PFAM:PF00934"
FT                   /protein_id="ADG76969.1"
FT                   /translation="MVGLNVAPIQLLSGTNEVIANVATTSGLVGGAAGTLGAVIPAGID
FT                   DVSLMVAAGSAAHAANYLAVTVVDHAAVAQYAVSLSAVAATYVAADNAVQF"
     MVGLNVAPIQ LLSGTNEVIA NVATTSGLVG GAAGTLGAVI PAGIDDVSLM VAAGSAAHAA        60
     NYLAVTVVDH AAVAQYAVSL SAVAATYVAA DNAVQF                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page