(data stored in ACNUC1104 zone)

EMBL: CP001966.PE317

CP001966.PE317       Location/Qualifiers
FT   CDS             338675..338974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76971"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76971.1"
FT                   /translation="MIYEMNTAAHAAGTATTEQIAQATLANIKFVRTTAEAYAAANSGQ
FT                   TSLKAVAHMHEIIAVCDAEQKKLENVGISLKQNNGLITNTDMDGGDIFQGYIGL"
     MIYEMNTAAH AAGTATTEQI AQATLANIKF VRTTAEAYAA ANSGQTSLKA VAHMHEIIAV        60
     CDAEQKKLEN VGISLKQNNG LITNTDMDGG DIFQGYIGL                               99
//

If you have problems or comments...

PBIL Back to PBIL home page